General Information

  • ID:  hor002119
  • Uniprot ID:  P51459
  • Protein name:  Insulin-like growth factor II
  • Gene name:  IGF2
  • Organism:  Equus caballus (Horse)
  • Family:  Insulin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Equus (genus), Equidae (family), Perissodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005159 insulin-like growth factor receptor binding; GO:0005178 integrin binding; GO:0005179 hormone activity; GO:0008083 growth factor activity; GO:0043539 protein serine/threonine kinase activator activity
  • GO BP:  GO:0000122 negative regulation of transcription by RNA polymerase II; GO:0001503 ossification; GO:0001701 in utero embryonic development; GO:0001892 embryonic placenta development; GO:0005975 carbohydrate metabolic process; GO:0006006 glucose metabolic process; GO:0007165 signal transduction; GO:0008284 positive regulation of cell population proliferation; GO:0042104 positive regulation of activated T cell proliferation; GO:0043410 positive regulation of MAPK cascade; GO:0045944 positive regulation of transcription by RNA polymerase II; GO:0046628 positive regulation of insulin receptor signaling pathway; GO:0050731 positive regulation of peptidyl-tyrosine phosphorylation
  • GO CC:  NA

Sequence Information

  • Sequence:  AYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRINRRSRGIVEECCFRSCDLALLETYCATPAKSE
  • Length:  67
  • Propeptide:  MGIPVGKSLLMLFTFLAFASCCIAAYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRINRRSRGIVEECCFRSCDLALLETYCATPAKSERDVSTPPTVLPDDSPRYPVVKLFQYNAWKQSTQRLRRGLPALLRTRRGRMLVKELEAFREAQRHRPLIALPTEDPTPHGAAFVEVSSDLQ
  • Signal peptide:  MGIPVGKSLLMLFTFLAFASCCIA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  The insulin-like growth factors possess growth-promoting activity. Major fetal growth hormone in mammals. Plays a key role in regulating fetoplacental development. IGF-II is influenced by placental lactogen. Also involved in tissue differentiation. Positively regulates myogenic transcription factor MYOD1 function by facilitating the recruitment of transcriptional coactivators, thereby controlling muscle terminal differentiation. In adults, involved in glucose metabolism in adipose tissue, skeletal muscle and liver. Acts as a ligand for integrin which is required for IGF2 signaling.
  • Mechanism:  The IGF2 locus is imprinted. Paternal inherited gene is expressed, while the maternal inherited gene is imprinted, hence silenced.
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  9-47; 21-60; 46-51
  • Structure ID:  AF-P51459-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor002119_AF2.pdbhor002119_ESM.pdb

Physical Information

Mass: 869391 Formula: C323H508N94O101S6
Absent amino acids: HMW Common amino acids: R
pI: 6.34 Basic residues: 9
Polar residues: 25 Hydrophobic residues: 20
Hydrophobicity: -25.52 Boman Index: -15038
Half-Life: 4.4 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 67.01
Instability Index: 7554.48 Extinction Coefficient cystines: 4845
Absorbance 280nm: 73.41

Literature

  • PubMed ID:  NA
  • Title:  NA